Loading...
Statistics
Kells Law Office, LLC | Client focused. Compassionate. Legal ...
www.kellslawoffice.com/
Kells Law Office, LLC is a client focused law firm conveniently located in downtown Columbus, Ohio.  The Kells Law Office is dedicated to providing ...
Kellslawoffice.com
Kellslawoffice.com is hosted in
United States
/
San Francisco
.
Kellslawoffice.com uses HTTPS protocol.
Number of used technologies:
8.
First technologies:
CSS, Google Font API, Gravatar,
Number of used javascripts: 3.
First javascripts:
Gprofiles.js, Wpgroho.js, W.js,
Number of used analytics tools:
1.
First analytics tools:
ComScore,
Its server type is:
nginx.
Its CMS is:
Wordpress.
Technologies in use by Kellslawoffice.com
Technology
Number of occurences: 8
- CSS
- Google Font API
- Gravatar
- Html
- Html5
- Javascript
- Php
- Pingback
Advertisement
Javascripts
Number of occurences: 3
- gprofiles.js
- wpgroho.js
- w.js
Content Management System
Number of occurences: 1
- Wordpress
Analytics
Number of occurences: 1
- comScore
Server Type
- nginx
Conversion rate optimization |
|
|---|---|
Clickable call number
|
Not founded! |
|
Conversion form (contact form, subcriber)
|
Founded! |
|
Clickable email
|
Not founded! |
|
CTA (call to action) button
|
Founded! |
|
List
|
Founded! |
|
Image
|
Not founded! |
|
Enhancement
|
Not founded! |
|
Responsive website
|
Founded! |
|
Facebook sharing
|
Not founded! |
|
Google+ sharing
|
Not founded! |
|
Twitter sharing
|
Not founded! |
|
Linkedin sharing
|
Not founded! |
|
Blog on the webiste
|
Not founded! |
HTTPS (SSL) - Kellslawoffice.com
SSL certificate
- name: /CN=tls.automattic.com
- subject:
- CN: tls.automattic.com
- hash: 6338c477
- issuer:
- C: US
- O: Let's Encrypt
- CN: Let's Encrypt Authority X3
- version: 2
- serialNumber: 342069340241276588909112058857236615574186
- validFrom: 160404115900Z
- validTo: 160703115900Z
- validFrom_time_t: 1459771140
- validTo_time_t: 1467547140
- extensions:
- keyUsage: Digital Signature, Key Encipherment
- extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
- basicConstraints: CA:FALSE
- subjectKeyIdentifier: 8B:C5:A3:E1:8C:39:A4:81:93:50:68:BA:C2:F8:DB:DC:D9:53:BE:FE
- authorityKeyIdentifier: keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1
- authorityInfoAccess: OCSP - URI:http://ocsp.int-x3.letsencrypt.org/ CA Issuers - URI:http://cert.int-x3.letsencrypt.org/
- subjectAltName: DNS:kelliewood.com, DNS:kellifannypack.com, DNS:kellifinglass.com, DNS:kelliforcountyclerk.com, DNS:kellifountainfairypaintings.com, DNS:kelligemmer.com, DNS:kelligizzi.com, DNS:kellihylandmd.com, DNS:kellikillion.com, DNS:kellimarieclark.com, DNS:kellimcastillo.com, DNS:kellimcgraw.com, DNS:kellimckinney.com, DNS:kellimercado.com, DNS:kellini.com, DNS:kellinkston.com, DNS:kellirobertsonphotography.com, DNS:kelliruns.com, DNS:kellisbookblog.com, DNS:kellisvegankitchen.com, DNS:kellitamakes.com, DNS:kellithelibrarian.com, DNS:kellivogstad.com, DNS:kelliwtaylor.com, DNS:kellizink.com, DNS:kellkell.com, DNS:kelloggconceptsconsulting.com, DNS:kelloggsbeachstairs.com, DNS:kelloncollington.com, DNS:kellseyandcharles.com, DNS:kellslawoffice.com, DNS:kelltay.com, DNS:kelltrill.com, DNS:kelluz.com, DNS:kelly-dambrosio.com, DNS:kelly-morse.com, DNS:kelly-wade.com, DNS:kelly015.com, DNS:kellyaatkins.com, DNS:kellyadediha.com, DNS:kellyaevans.com, DNS:kellyakenna.com, DNS:kellyamidonblog.com, DNS:kellyanddad.com, DNS:kellyanddaviesdogwalking.com, DNS:kellyandellieimperfectdietitians.com, DNS:kellyandersen.com, DNS:kellyandgeoff.com, DNS:kellyandjekelduo.com, DNS:kellyandjessicaforever.com, DNS:tls.automattic.com
- certificatePolicies: Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org User Notice: Explicit Text: This Certificate may only be relied upon by Relying Parties and only in accordance with the Certificate Policy found at https://letsencrypt.org/repository/
Number of occurences: 13
- Name:
Content: https://www.facebook.com/WordPresscom - Name: viewport
Content: width=device-width - Name: google-site-verification
Content: B4g0EvhBmbQE47SybcbiRFBDxr63ayciNV15GjIWfUU - Name: generator
Content: WordPress.com - Name: twitter:site
Content: @wordpressdotcom - Name: twitter:card
Content: summary - Name: theme-color
Content: #093d69 - Name: application-name
Content: Kells Law Office, LLC - Name: msapplication-window
Content: width=device-width;height=device-height - Name: msapplication-tooltip
Content: Client focused. Compassionate. Legal services. - Name: msapplication-task
Content: name=WordPress.com Forums;action-uri=http://forums.wordpress.com/;icon-uri=https://s2.wp.com/i/favicon.ico - Name: title
Content: Welcome | Kells Law Office, LLC on WordPress.com - Name: description
Content: Kells Law Office, LLC is a client focused law firm conveniently located in downtown Columbus, Ohio.  The Kells Law Office is dedicated to providing clients with high quality and cost effective legal services. We provide our clients with personal service and trusted advice.  We focus on our clients' goals with integrity and respect. We understand that people have legal problems and concerns.  Contact us today to learn more about…
Server / Hosting
- IP: 192.0.78.24
- Latitude: 37.75
- Longitude: -122.42
- Country: United States
- City: San Francisco
Rname
- ns3.wordpress.com
- ns1.wordpress.com
- ns2.wordpress.com
- ASPMX.L.GOOGLE.com
Target
- hostmaster.wordpress.com
HTTP Header Response
HTTP/1.1 301 Moved Permanently
Server: nginx
Date: Mon, 13 Jun 2016 03:37:34 GMT
Content-Type: text/html
Content-Length: 178
Location: https://kellslawoffice.com/
X-ac: 3.dfw _dfw
X-Cache: MISS from s_mf15
X-Cache-Lookup: MISS from s_mf15:80
Via: 1.1 s_mf15 (squid/3.5.6)
Connection: keep-alive
HTTP/1.1 200 Connection established
HTTP/1.1 200 OK
Server: nginx
Date: Mon, 13 Jun 2016 03:37:35 GMT
Content-Type: text/html; charset=UTF-8
Connection: keep-alive
Strict-Transport-Security: max-age=86400
Vary: Accept-Encoding
Vary: Cookie
X-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header.
X-Pingback: https://kellslawoffice.com/xmlrpc.php
Link: ; rel=shortlink
X-ac: 3.dfw _dfw
DNS
host: kellslawoffice.com
- class: IN
- ttl: 300
- type: A
- ip: 192.0.78.25
host: kellslawoffice.com
- class: IN
- ttl: 300
- type: A
- ip: 192.0.78.24
host: kellslawoffice.com
- class: IN
- ttl: 86400
- type: NS
- target: ns3.wordpress.com
host: kellslawoffice.com
- class: IN
- ttl: 86400
- type: NS
- target: ns1.wordpress.com
host: kellslawoffice.com
- class: IN
- ttl: 86400
- type: NS
- target: ns2.wordpress.com
host: kellslawoffice.com
- class: IN
- ttl: 86400
- type: SOA
- mname: ns1.wordpress.com
- rname: hostmaster.wordpress.com
- serial: 2005071858
- refresh: 14400
- retry: 7200
- expire: 604800
- minimum-ttl: 300
host: kellslawoffice.com
- class: IN
- ttl: 3600
- type: MX
- pri: 1
- target: ASPMX.L.GOOGLE.com
Common Typos/Mistakes
This list shows You some spelling mistakes at internet search for this domain.
www.ellslawoffice.com, www.ktellslawoffice.com, www.tellslawoffice.com, www.kellslawoffice.com, www.ellslawoffice.com, www.kgellslawoffice.com, www.gellslawoffice.com, www.kbellslawoffice.com, www.bellslawoffice.com, www.knellslawoffice.com, www.nellslawoffice.com, www.khellslawoffice.com, www.hellslawoffice.com, www.kyellslawoffice.com, www.yellslawoffice.com, www.klellslawoffice.com, www.lellslawoffice.com, www.koellslawoffice.com, www.oellslawoffice.com, www.kuellslawoffice.com, www.uellslawoffice.com, www.kiellslawoffice.com, www.iellslawoffice.com, www.kmellslawoffice.com, www.mellslawoffice.com, www.kllslawoffice.com, www.kexllslawoffice.com, www.kxllslawoffice.com, www.kesllslawoffice.com, www.ksllslawoffice.com, www.kewllslawoffice.com, www.kwllslawoffice.com, www.kerllslawoffice.com, www.krllslawoffice.com, www.kefllslawoffice.com, www.kfllslawoffice.com, www.kevllslawoffice.com, www.kvllslawoffice.com, www.kecllslawoffice.com, www.kcllslawoffice.com, www.keqllslawoffice.com, www.kqllslawoffice.com, www.keallslawoffice.com, www.kallslawoffice.com, www.keyllslawoffice.com, www.kyllslawoffice.com, www.kelslawoffice.com, www.kelulslawoffice.com, www.keulslawoffice.com, www.kel8lslawoffice.com, www.ke8lslawoffice.com, www.kel9lslawoffice.com, www.ke9lslawoffice.com, www.keljlslawoffice.com, www.kejlslawoffice.com, www.kel0lslawoffice.com, www.ke0lslawoffice.com, www.kelmlslawoffice.com, www.kemlslawoffice.com, www.kelplslawoffice.com, www.keplslawoffice.com, www.kelolslawoffice.com, www.keolslawoffice.com, www.kelslawoffice.com, www.kelluslawoffice.com, www.keluslawoffice.com, www.kell8slawoffice.com, www.kel8slawoffice.com, www.kell9slawoffice.com, www.kel9slawoffice.com, www.kelljslawoffice.com, www.keljslawoffice.com, www.kell0slawoffice.com, www.kel0slawoffice.com, www.kellmslawoffice.com, www.kelmslawoffice.com, www.kellpslawoffice.com, www.kelpslawoffice.com, www.kelloslawoffice.com, www.keloslawoffice.com, www.kelllawoffice.com, www.kellselawoffice.com, www.kellelawoffice.com, www.kellswlawoffice.com, www.kellwlawoffice.com, www.kellsdlawoffice.com, www.kelldlawoffice.com, www.kellsxlawoffice.com, www.kellxlawoffice.com, www.kellsflawoffice.com, www.kellflawoffice.com, www.kellsglawoffice.com, www.kellglawoffice.com, www.kellstlawoffice.com, www.kelltlawoffice.com, www.kellsawoffice.com, www.kellsluawoffice.com, www.kellsuawoffice.com, www.kellsl8awoffice.com, www.kells8awoffice.com, www.kellsl9awoffice.com, www.kells9awoffice.com, www.kellsljawoffice.com, www.kellsjawoffice.com, www.kellsl0awoffice.com, www.kells0awoffice.com, www.kellslmawoffice.com, www.kellsmawoffice.com, www.kellslpawoffice.com, www.kellspawoffice.com, www.kellsloawoffice.com, www.kellsoawoffice.com, www.kellslwoffice.com, www.kellslaowoffice.com, www.kellslowoffice.com, www.kellslapwoffice.com, www.kellslpwoffice.com, www.kellsla9woffice.com, www.kellsl9woffice.com, www.kellslawoffice.com, www.kellslwoffice.com, www.kellslaiwoffice.com, www.kellsliwoffice.com, www.kellslauwoffice.com, www.kellsluwoffice.com, www.kellslaoffice.com, www.kellslaw office.com, www.kellsla office.com, www.kellslawcoffice.com, www.kellslacoffice.com, www.kellslawoffice.com, www.kellslaoffice.com, www.kellslawdoffice.com, www.kellsladoffice.com, www.kellslawfoffice.com, www.kellslafoffice.com, www.kellslawgoffice.com, www.kellslagoffice.com, www.kellslawboffice.com, www.kellslaboffice.com, www.kellslawffice.com, www.kellslawobffice.com, www.kellslawbffice.com, www.kellslawohffice.com, www.kellslawhffice.com, www.kellslawogffice.com, www.kellslawgffice.com, www.kellslawojffice.com, www.kellslawjffice.com, www.kellslawomffice.com, www.kellslawmffice.com, www.kellslawo ffice.com, www.kellslaw ffice.com, www.kellslawovffice.com, www.kellslawvffice.com, www.kellslawofice.com, www.kellslawofqfice.com, www.kellslawoqfice.com, www.kellslawoffice.com, www.kellslawofice.com, www.kellslawofafice.com, www.kellslawoafice.com, www.kellslawofyfice.com, www.kellslawoyfice.com, www.kellslawoftfice.com, www.kellslawotfice.com, www.kellslawofgfice.com, www.kellslawogfice.com, www.kellslawofbfice.com, www.kellslawobfice.com, www.kellslawofwfice.com, www.kellslawowfice.com, www.kellslawofsfice.com, www.kellslawosfice.com, www.kellslawofdfice.com, www.kellslawodfice.com, www.kellslawofrfice.com, www.kellslaworfice.com, www.kellslawof3fice.com, www.kellslawo3fice.com, www.kellslawof4fice.com, www.kellslawo4fice.com,
Other websites we recently analyzed
- Singapore jobs for Filipinos | Sg jobs for Pinoys
France - 195.154.51.124
Server software: Apache/2.2.31 (Unix) mod_ssl/2.2.31 OpenSSL/1.0.1e-fips mod_bwlimited/1.4
Technology: InfoLinks, CSS, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
Number of Javascript: 4
Number of meta tags: 4 -
Hemkörning Pizza Umeå - Pizza Hemkörning Umeå | Sushi | indisk | Kinesisk - Pizza Hemkörning Umeå | Sushi | indisk | Kinesisk
Hemkörning Pizza Umeå | BÄSTA RESTAURANGERNA LEVERERAT HEM TILL DIG inom 30 - 60 minuter från beställning. Vi levererar Hemkörning Pizza Umeå snabbtSweden - 195.74.38.180
G Analytics ID: UA-56545606-1
Server software: Apache
Technology: BootstrapCDN, Maxcdn, OSS CDN, AJAX Libraries API, CSS, Font Awesome, Html, Html5, Javascript, jQuery, jQuery UI, Php, Pingback, SVG, W3 Total cache, Google Analytics, Wordpress
Number of Javascript: 30
Number of meta tags: 9 - - Dance like you don't give a ...Dansmoln | Dance like you don't give a …
Dansmoln är en blogg om dans och livetDenmark - 46.30.213.240
G Analytics ID: UA-70821545-1
Server software: Apache
Technology: CSS, Html, Html5, Javascript, jQuery, jQuery Validate, Php, Pingback, Google Analytics, Wordpress, Facebook Box, Google +1 Button, Linkedin Share button, Twitter Button
Number of Javascript: 12
Number of meta tags: 8 -
Photography by Ron Ross
Every person, wedding and event is beautiful. Fleeting moments when captured become timeless. I capture those moments. "Capture The Memories" My professional photography expertise is based on more than 30 years experience capturing special people,. Photography by Ron Ross, 605 Walnut Ave., Charlotte, NC 28208-4537, United StatesEurope - 95.100.248.112
Server software:
Technology: CSS, Google Font API, Html, Html5, Javascript
Number of Javascript: 1
Number of meta tags: 3 - Welcome to Foothills Rostrum Club 11
Rostrum teaches public speaking skills. Rostrum really works. Anyone who needs to beome a better speaker, communicator or presenter for business or personalCanberra (Australia) - 175.107.174.103
Server software: Apache
Technology: CSS, Html, Html5, Javascript, jQuery, jQuery UI, Php, Pingback, Google Analytics, Wordpress, Facebook Box
Number of Javascript: 15
Number of meta tags: 5 - :::: SK - BCN :::
Spain - 89.140.72.153
Server software: nginx
Technology: CSS, Html, Javascript, jQuery Cycle, Php, Google Analytics
Number of Javascript: 5
Number of meta tags: 1 - Hydraulik Wrocław i okolice - 501326834.
Usługi hydrauliczne, kotłownie, ogrzewanie podłogowe i grzejnikowe, instalacje wodne i kanalizacyjne. ACV, ATAG, AUER, BIAWAR - sprzedaż, montaż, serwis.Poland - 79.133.210.186
G Analytics ID: UA-45772854-2
Server software: Apache
Technology: CSS, Google Font API, Html, Javascript, Google Analytics, Google AdWords Conversion Tracking
Number of Javascript: 3
Number of meta tags: 4 - æ²³å—ä¸å»ºåŽä¼šè®¡å¸ˆäº‹åŠ¡æ‰€æœ‰é™å…¬å¸
Beijing (China) - 218.241.17.226
Server software: Apache
Technology: CSS, Html, Javascript, Php, Swf Object
Number of Javascript: 2
Number of meta tags: 3 - kevinbullard.co.uk
Germany - 217.160.122.11
Server software: Apache
Technology: Html
Number of meta tags: 1 - patrioticamericanapparel.com
Provo (United States) - 50.87.144.192
Server software: nginx/1.10.1
Technology: Html
Number of meta tags: 2