Loading...
Statistics
Advertisement

Kells Law Office, LLC | Client focused. Compassionate. Legal ...
www.kellslawoffice.com/
Kells Law Office, LLC is a client focused law firm conveniently located in downtown Columbus, Ohio.  The Kells Law Office is dedicated to providing ...

Kellslawoffice.com

Advertisement
Kellslawoffice.com is hosted in United States / San Francisco . Kellslawoffice.com uses HTTPS protocol. Number of used technologies: 8. First technologies: CSS, Google Font API, Gravatar, Number of used javascripts: 3. First javascripts: Gprofiles.js, Wpgroho.js, W.js, Number of used analytics tools: 1. First analytics tools: ComScore, Its server type is: nginx. Its CMS is: Wordpress.

Technologies in use by Kellslawoffice.com

Technology

Number of occurences: 8
  • CSS
  • Google Font API
  • Gravatar
  • Html
  • Html5
  • Javascript
  • Php
  • Pingback

Advertisement

Javascripts

Number of occurences: 3
  • gprofiles.js
  • wpgroho.js
  • w.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 1
  • comScore

Server Type

  • nginx

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Kellslawoffice.com

SSL certificate

    • name: /CN=tls.automattic.com
    • subject:
      • CN: tls.automattic.com
    • hash: 6338c477
    • issuer:
      • C: US
      • O: Let's Encrypt
      • CN: Let's Encrypt Authority X3
    • version: 2
    • serialNumber: 342069340241276588909112058857236615574186
    • validFrom: 160404115900Z
    • validTo: 160703115900Z
    • validFrom_time_t: 1459771140
    • validTo_time_t: 1467547140
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • basicConstraints: CA:FALSE
      • subjectKeyIdentifier: 8B:C5:A3:E1:8C:39:A4:81:93:50:68:BA:C2:F8:DB:DC:D9:53:BE:FE
      • authorityKeyIdentifier: keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1
      • authorityInfoAccess: OCSP - URI:http://ocsp.int-x3.letsencrypt.org/ CA Issuers - URI:http://cert.int-x3.letsencrypt.org/
      • subjectAltName: DNS:kelliewood.com, DNS:kellifannypack.com, DNS:kellifinglass.com, DNS:kelliforcountyclerk.com, DNS:kellifountainfairypaintings.com, DNS:kelligemmer.com, DNS:kelligizzi.com, DNS:kellihylandmd.com, DNS:kellikillion.com, DNS:kellimarieclark.com, DNS:kellimcastillo.com, DNS:kellimcgraw.com, DNS:kellimckinney.com, DNS:kellimercado.com, DNS:kellini.com, DNS:kellinkston.com, DNS:kellirobertsonphotography.com, DNS:kelliruns.com, DNS:kellisbookblog.com, DNS:kellisvegankitchen.com, DNS:kellitamakes.com, DNS:kellithelibrarian.com, DNS:kellivogstad.com, DNS:kelliwtaylor.com, DNS:kellizink.com, DNS:kellkell.com, DNS:kelloggconceptsconsulting.com, DNS:kelloggsbeachstairs.com, DNS:kelloncollington.com, DNS:kellseyandcharles.com, DNS:kellslawoffice.com, DNS:kelltay.com, DNS:kelltrill.com, DNS:kelluz.com, DNS:kelly-dambrosio.com, DNS:kelly-morse.com, DNS:kelly-wade.com, DNS:kelly015.com, DNS:kellyaatkins.com, DNS:kellyadediha.com, DNS:kellyaevans.com, DNS:kellyakenna.com, DNS:kellyamidonblog.com, DNS:kellyanddad.com, DNS:kellyanddaviesdogwalking.com, DNS:kellyandellieimperfectdietitians.com, DNS:kellyandersen.com, DNS:kellyandgeoff.com, DNS:kellyandjekelduo.com, DNS:kellyandjessicaforever.com, DNS:tls.automattic.com
      • certificatePolicies: Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org User Notice: Explicit Text: This Certificate may only be relied upon by Relying Parties and only in accordance with the Certificate Policy found at https://letsencrypt.org/repository/

Meta - Kellslawoffice.com

Number of occurences: 13
  • Name:
    Content: https://www.facebook.com/WordPresscom
  • Name: viewport
    Content: width=device-width
  • Name: google-site-verification
    Content: B4g0EvhBmbQE47SybcbiRFBDxr63ayciNV15GjIWfUU
  • Name: generator
    Content: WordPress.com
  • Name: twitter:site
    Content: @wordpressdotcom
  • Name: twitter:card
    Content: summary
  • Name: theme-color
    Content: #093d69
  • Name: application-name
    Content: Kells Law Office, LLC
  • Name: msapplication-window
    Content: width=device-width;height=device-height
  • Name: msapplication-tooltip
    Content: Client focused. Compassionate. Legal services.
  • Name: msapplication-task
    Content: name=WordPress.com Forums;action-uri=http://forums.wordpress.com/;icon-uri=https://s2.wp.com/i/favicon.ico
  • Name: title
    Content: Welcome | Kells Law Office, LLC on WordPress.com
  • Name: description
    Content: Kells Law Office, LLC is a client focused law firm conveniently located in downtown Columbus, Ohio.  The Kells Law Office is dedicated to providing clients with high quality and cost effective legal services.  We provide our clients with personal service and trusted advice.  We focus on our clients' goals with integrity and respect.  We understand that people have legal problems and concerns.  Contact us today to learn more about…

Server / Hosting

  • IP: 192.0.78.24
  • Latitude: 37.75
  • Longitude: -122.42
  • Country: United States
  • City: San Francisco

Rname

  • ns3.wordpress.com
  • ns1.wordpress.com
  • ns2.wordpress.com
  • ASPMX.L.GOOGLE.com

Target

  • hostmaster.wordpress.com

HTTP Header Response

HTTP/1.1 301 Moved Permanently Server: nginx Date: Mon, 13 Jun 2016 03:37:34 GMT Content-Type: text/html Content-Length: 178 Location: https://kellslawoffice.com/ X-ac: 3.dfw _dfw X-Cache: MISS from s_mf15 X-Cache-Lookup: MISS from s_mf15:80 Via: 1.1 s_mf15 (squid/3.5.6) Connection: keep-alive HTTP/1.1 200 Connection established HTTP/1.1 200 OK Server: nginx Date: Mon, 13 Jun 2016 03:37:35 GMT Content-Type: text/html; charset=UTF-8 Connection: keep-alive Strict-Transport-Security: max-age=86400 Vary: Accept-Encoding Vary: Cookie X-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header. X-Pingback: https://kellslawoffice.com/xmlrpc.php Link: ; rel=shortlink X-ac: 3.dfw _dfw

DNS

host: kellslawoffice.com
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 192.0.78.25
host: kellslawoffice.com
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 192.0.78.24
host: kellslawoffice.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns3.wordpress.com
host: kellslawoffice.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.wordpress.com
host: kellslawoffice.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.wordpress.com
host: kellslawoffice.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.wordpress.com
  5. rname: hostmaster.wordpress.com
  6. serial: 2005071858
  7. refresh: 14400
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 300
host: kellslawoffice.com
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 1
  5. target: ASPMX.L.GOOGLE.com

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.ellslawoffice.com, www.ktellslawoffice.com, www.tellslawoffice.com, www.kellslawoffice.com, www.ellslawoffice.com, www.kgellslawoffice.com, www.gellslawoffice.com, www.kbellslawoffice.com, www.bellslawoffice.com, www.knellslawoffice.com, www.nellslawoffice.com, www.khellslawoffice.com, www.hellslawoffice.com, www.kyellslawoffice.com, www.yellslawoffice.com, www.klellslawoffice.com, www.lellslawoffice.com, www.koellslawoffice.com, www.oellslawoffice.com, www.kuellslawoffice.com, www.uellslawoffice.com, www.kiellslawoffice.com, www.iellslawoffice.com, www.kmellslawoffice.com, www.mellslawoffice.com, www.kllslawoffice.com, www.kexllslawoffice.com, www.kxllslawoffice.com, www.kesllslawoffice.com, www.ksllslawoffice.com, www.kewllslawoffice.com, www.kwllslawoffice.com, www.kerllslawoffice.com, www.krllslawoffice.com, www.kefllslawoffice.com, www.kfllslawoffice.com, www.kevllslawoffice.com, www.kvllslawoffice.com, www.kecllslawoffice.com, www.kcllslawoffice.com, www.keqllslawoffice.com, www.kqllslawoffice.com, www.keallslawoffice.com, www.kallslawoffice.com, www.keyllslawoffice.com, www.kyllslawoffice.com, www.kelslawoffice.com, www.kelulslawoffice.com, www.keulslawoffice.com, www.kel8lslawoffice.com, www.ke8lslawoffice.com, www.kel9lslawoffice.com, www.ke9lslawoffice.com, www.keljlslawoffice.com, www.kejlslawoffice.com, www.kel0lslawoffice.com, www.ke0lslawoffice.com, www.kelmlslawoffice.com, www.kemlslawoffice.com, www.kelplslawoffice.com, www.keplslawoffice.com, www.kelolslawoffice.com, www.keolslawoffice.com, www.kelslawoffice.com, www.kelluslawoffice.com, www.keluslawoffice.com, www.kell8slawoffice.com, www.kel8slawoffice.com, www.kell9slawoffice.com, www.kel9slawoffice.com, www.kelljslawoffice.com, www.keljslawoffice.com, www.kell0slawoffice.com, www.kel0slawoffice.com, www.kellmslawoffice.com, www.kelmslawoffice.com, www.kellpslawoffice.com, www.kelpslawoffice.com, www.kelloslawoffice.com, www.keloslawoffice.com, www.kelllawoffice.com, www.kellselawoffice.com, www.kellelawoffice.com, www.kellswlawoffice.com, www.kellwlawoffice.com, www.kellsdlawoffice.com, www.kelldlawoffice.com, www.kellsxlawoffice.com, www.kellxlawoffice.com, www.kellsflawoffice.com, www.kellflawoffice.com, www.kellsglawoffice.com, www.kellglawoffice.com, www.kellstlawoffice.com, www.kelltlawoffice.com, www.kellsawoffice.com, www.kellsluawoffice.com, www.kellsuawoffice.com, www.kellsl8awoffice.com, www.kells8awoffice.com, www.kellsl9awoffice.com, www.kells9awoffice.com, www.kellsljawoffice.com, www.kellsjawoffice.com, www.kellsl0awoffice.com, www.kells0awoffice.com, www.kellslmawoffice.com, www.kellsmawoffice.com, www.kellslpawoffice.com, www.kellspawoffice.com, www.kellsloawoffice.com, www.kellsoawoffice.com, www.kellslwoffice.com, www.kellslaowoffice.com, www.kellslowoffice.com, www.kellslapwoffice.com, www.kellslpwoffice.com, www.kellsla9woffice.com, www.kellsl9woffice.com, www.kellslawoffice.com, www.kellslwoffice.com, www.kellslaiwoffice.com, www.kellsliwoffice.com, www.kellslauwoffice.com, www.kellsluwoffice.com, www.kellslaoffice.com, www.kellslaw office.com, www.kellsla office.com, www.kellslawcoffice.com, www.kellslacoffice.com, www.kellslawoffice.com, www.kellslaoffice.com, www.kellslawdoffice.com, www.kellsladoffice.com, www.kellslawfoffice.com, www.kellslafoffice.com, www.kellslawgoffice.com, www.kellslagoffice.com, www.kellslawboffice.com, www.kellslaboffice.com, www.kellslawffice.com, www.kellslawobffice.com, www.kellslawbffice.com, www.kellslawohffice.com, www.kellslawhffice.com, www.kellslawogffice.com, www.kellslawgffice.com, www.kellslawojffice.com, www.kellslawjffice.com, www.kellslawomffice.com, www.kellslawmffice.com, www.kellslawo ffice.com, www.kellslaw ffice.com, www.kellslawovffice.com, www.kellslawvffice.com, www.kellslawofice.com, www.kellslawofqfice.com, www.kellslawoqfice.com, www.kellslawoffice.com, www.kellslawofice.com, www.kellslawofafice.com, www.kellslawoafice.com, www.kellslawofyfice.com, www.kellslawoyfice.com, www.kellslawoftfice.com, www.kellslawotfice.com, www.kellslawofgfice.com, www.kellslawogfice.com, www.kellslawofbfice.com, www.kellslawobfice.com, www.kellslawofwfice.com, www.kellslawowfice.com, www.kellslawofsfice.com, www.kellslawosfice.com, www.kellslawofdfice.com, www.kellslawodfice.com, www.kellslawofrfice.com, www.kellslaworfice.com, www.kellslawof3fice.com, www.kellslawo3fice.com, www.kellslawof4fice.com, www.kellslawo4fice.com,

Other websites we recently analyzed

  1. chicushion.com
    Wayne (United States) - 216.250.120.194
    Server software: Apache
    Technology: Html
    Number of meta tags: 1
  2. cabpro.us
    Road Town (Virgin Islands, British) - 208.91.197.44
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  3. Queen Nails, Relax & Pamper Yourself
    Queen Nails Online
    Provo (United States) - 74.220.215.115
    Server software: nginx/1.10.1
    Technology: AJAX Libraries API, CSS, Html, Javascript, Php
    Number of Javascript: 5
    Number of meta tags: 6
  4. zegikakuga.xyz
    San Antonio (United States) - 23.253.164.103
    Server software: nginx
    Technology: Html, Javascript
    Number of Javascript: 1
  5. advanced-cleaning.uk.com
    San Jose (United States) - 205.164.14.88
    Server software: Tengine/1.4.2
    Technology: Google Adsense, Html, Javascript, Php
    Number of Javascript: 2
    Number of meta tags: 1
  6. Celestte | SPA, SALON & MAKEOVERS
    India - 103.24.200.126
    Server software: Apache
    Technology: CSS, Html, Html5, Iframe, Javascript, jQuery, MediaElement, Php, Pingback, Revslider, Wordpress, Facebook Like box
    Number of Javascript: 28
    Number of meta tags: 3
  7. Kr@biSummerhouse
    Denmark - 94.231.107.248
    Server software: Microsoft-IIS/8.5
    Technology: CSS, Html, Javascript, Php
    Number of Javascript: 4
  8. Matt Kenchington Comedy Filmmaker
    Matt Kenchington is a Los Angeles based comedy filmmaker. Check out the site for previews of his work as a comedy filmmaker.
    Atlanta (United States) - 216.157.102.147
    Server software: Apache
    Technology: CSS, Html, Html5, Javascript, Php, Pingback, Revslider, Shortcodes, Google Analytics, Wordpress
    Number of Javascript: 6
    Number of meta tags: 6
  9. Home
    Scottsdale (United States) - 72.167.232.6
    Server software: Apache
    Technology: Html, Javascript
    Number of Javascript: 1
    Number of meta tags: 2
  10. ::. RIBEIRO TRANSPORTE E LOGÍSTICA LTDA .::
    RIBEIRO TRANSPORTES LTDA - transporte,transportadora,entrega,bahia,salvador,brasil,veículos,logistica,transportadoras,carga,cargas,carga fracionada,transportadora na bahia, transportadora bahia, transportadora salvador
    Brazil - 187.17.111.99
    Server software: Microsoft-IIS/8.0
    Technology: CSS, Html, Javascript, Swf Object, Google Analytics
    Number of meta tags: 14

Check Other Websites